PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c10_17500V3.5.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family NF-YB
Protein Properties Length: 167aa    MW: 17983.3 Da    PI: 4.8042
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c10_17500V3.5.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB67.23e-2126108890
               NF-YB   8 lPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90 
                         l  a +++i+k++lP + +++kda++++ ec +efi +++se+++ c +e+++ti+++ +l al  lGf +y+ +++  ++++
  Pp3c10_17500V3.5.p  26 LRAATMTKIIKEMLPPDVRVAKDAQDLLVECCVEFINLISSESNEICSKEEKRTIAPEHVLRALEILGFGEYMGEVQGAFEQH 108
                         566899*******************************************************************9987666555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471134.64E-3025151IPR009072Histone-fold
PfamPF008081.4E-192689IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.101.2E-3326152IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 167 aa     Download sequence    Send to blast
MDTAAGRPKD DVSLPKDGGL HTFIHLRAAT MTKIIKEMLP PDVRVAKDAQ DLLVECCVEF  60
INLISSESNE ICSKEEKRTI APEHVLRALE ILGFGEYMGE VQGAFEQHKN ETLESPKVGG  120
RWAKEGGGGM TEEEAIAAQQ RMFAEARARM NSAGAPAPSA QANDSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_B5e-351014712133Transcription Regulator NC2 beta chain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001774769.13e-98predicted protein
SwissprotP495922e-66NC2B_ARATH; Protein Dr1 homolog
TrEMBLA9T7Z64e-98A9T7Z6_PHYPA; Predicted protein
STRINGPP1S181_25V6.11e-121(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23090.21e-67nuclear factor Y, subunit B13